missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MRG15 (aa 6-77) Control Fragment Recombinant Protein

Product Code. 30213493
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213493

Brand: Invitrogen™ RP91313

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83604 (PA5-83604. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MRG15 ia a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome-DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis and DNA repair.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q9UBU8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10933
Name Human MRG15 (aa 6-77) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Eaf3; Esa1p-associated factor 3 homolog; FWP006; HSPC008; HSPC061; HsT17725; MEAF3; MGC10631; mKIAA4002; Morf4l1; MORF-related gene 15 protein; MORF-related gene on chromosome 15; MORFRG15; mortality factor 4 like 1; mortality factor 4-like protein 1; MRG15; PP368; Protein MSL3-1; S863-6; TEG-189; testis expressed gene 189; testis-expressed gene 189 protein; Te x 189; transcription factor-like protein MRG15
Common Name MRG15
Gene Symbol MORF4L1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.