Invitrogen™ Human MRCK gamma (aa 1121-1197) Control Fragment Recombinant Protein

Product Code. 30212536

Brand: Invitrogen™ RP103424

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63988 (PA5-63988. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDC42 BPG serine/threonine kinase is encoded by the CDC42BPG gene. It acts as a downstream effector of CDC42 in cytoskeletal reorganization, and contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and MLC2 phosphorylation. It belongs to the AGC protein kinase family, DMPK subfamily. It contains an N-terminal kinase domain, followed by a coiled-coil domain, a second coiled-coil domain containing a kinase inhibitory motif (KIM), a variable region, a cysteine-rich domain, a pleckstrin (PLEK; 173570) homology (PH) domain, a citron (605629) homology (CNH) domain, and a C-terminal CDC42 (116952)/RAC (602048) interactive binding (CRIB) domain.

Specifications

• Accession Number: Q6DT37
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55561
• Name: Human MRCK gamma (aa 1121-1197) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC046418; CDC42 binding protein kinase gamma; CDC42 binding protein kinase gamma (DMPK-like); CDC42-binding protein kinase gamma; CDC42BPG; DMPK2; DMPK-like gamma; HSMDPKIN; KAPPA-200; MRCK gamma; MRCKG; MRCKgamma; Myotonic dystrophy kinase-related CDC42-binding kinase gamma; myotonic dystrophy protein kinase like protein; myotonic dystrophy protein kinase-like alpha; myotonic dystrophy protein kinase-like gamma; serine/threonine-protein kinase MRCK gamma
• Common Name: MRCK gamma
• Gene Symbol: CDC42BPG
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SNDIFQVGECRRVQQLTLSPSAGLLVVLCGRGPSVRLFALAELENIEVAGAKIPESRGCQVLAAGSILQARTPVLCV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining