Invitrogen™ Human MRCK beta (aa 1526-1674) Control Fragment Recombinant Protein

Product Code. 30196056

Brand: Invitrogen™ RP88988

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54613 (PA5-54613. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDC42BPB is a serine/threonine kinases which functions in actin cytoskeleton assembly and organization. Myotonic dystrophy kinaserelated Cdc42-binding (DMPK-like) kinases-alpha and beta (MRCK-alpha, beta) contain a cysteine-rich motif and a putative pleckstrin homology domain. MRCKs can phosphorylate nonmuscle Myosin light chain and influences Actin-Myosin contractility. MRCK-alpha can phosphorylate and activate LIM kinases downstream of Cdc42, which leads to inactivation of ADF/Cofilin and to Actin cytoskeletal reorganization. MRCK-alpha can also influence neurite outgrowth promoted by Cdc42 and Rac.

Specifications

• Accession Number: Q9Y5S2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9578
• Name: Human MRCK beta (aa 1526-1674) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CDC42 binding protein kinase beta; CDC42 binding protein kinase beta (DMPK-like); CDC42-binding protein kinase beta; CDC42-binding protein kinase beta (DMPK-like); CDC42BPB; cdc42bpb {ECO:0000312; CDC42BP-beta; DMPK-like beta; EMBL:AAP34403.1}; Kiaa1124; MRCK beta; MRCKb; myotonic dystrophy kinase related CDC42 binding kinase beta; myotonic dystrophy kinase-related CDC42-binding kinase beta; myotonic dystrophy protein kinase like beta; myotonic dystrophy protein kinase-like beta; serine/threonine-protein kinase MRCK beta
• Common Name: MRCK beta
• Gene Symbol: CDC42BPB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining