Invitrogen™ Human MRAP (aa 1-37) Control Fragment Recombinant Protein

Product Code. 30210825

Brand: Invitrogen™ RP90458

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52775 (PA5-52775. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MRAP encodes a melanocortin receptor-interacting protein. The encoded protein regulates trafficking and function of the melanocortin 2 receptor in the adrenal gland. The encoded protein can also modulate signaling of other melanocortin receptors. Mutations in this gene have been associated with familial glucocorticoid deficiency type 2.

Specifications

• Accession Number: Q8TCY5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56246
• Name: Human MRAP (aa 1-37) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110025G12Rik; B27; C21orf61; Falp; Fat cell-specific low molecular weight protein; fat tissue-specific low MW protein; FGD2; GCCD2; melanocortin 2 receptor accessory protein; melanocortin-2 receptor accessory protein; Mrap; ORF61
• Common Name: MRAP
• Gene Symbol: Mrap
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining