Invitrogen™ Human MPV17L2 (aa 122-206) Control Fragment Recombinant Protein

Product Code. 30181141

Brand: Invitrogen™ RP99025

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60245 (PA5-60245. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FKSG24 is a multi-pass membrane proteinPotential. It belongs to the peroxisomal membrane protein PXMP2/4 family. The exact function of FKSG24 remains unknown.

Specifications

• Accession Number: Q567V2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84769
• Name: Human MPV17L2 (aa 122-206) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FKSG24; MPV17 mitochondrial inner membrane protein like 2; MPV17 mitochondrial membrane protein-like 2; MPV17L2; mpv17-like protein 2
• Common Name: MPV17L2
• Gene Symbol: MPV17L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining