Invitrogen™ Human MPV17L (aa 167-196) Control Fragment Recombinant Protein

Product Code. 30180463

Brand: Invitrogen™ RP98687

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59471 (PA5-59471. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Isoform 1 participates in reactive oxygen species metabolism by up- or down-regulation of the genes of antioxidant enzymes.

Specifications

• Accession Number: Q2QL34
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 255027
• Name: Human MPV17L (aa 167-196) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: M-LP; M-LP homolog; M-LPH; MLPH1; MLPH2; MPV17 mitochondrial inner membrane protein like; MPV17 mitochondrial membrane protein-like; Mpv17 transgene, kidney disease mutant-like; MPV17L; MPV17L1; mpv17-like protein; Mpv17-like protein type 1; Mpv17-like protein type 2
• Common Name: MPV17L
• Gene Symbol: Mpv17l
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SQQSGDGTFKSAFTILYTKGTSATEGYPKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining