missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MPP2 (aa 147-178) Control Fragment Recombinant Protein

Product Code. 30212115
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212115

Brand: Invitrogen™ RP109349

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The MAGUK (membrane-associated guanylate kinase homologs) family of proteins contain multiple protein-binding domains and are involved in cell junction organization, tumor suppression and signaling. The MAGUK family is divided into four subfamilies: DLG-like, ZO1-like, p55-like and LIN2-like. MPP2 (membrane protein, palmitoylated 2), also known as MAGUK p55 subfamily member 2, discs large homolog 2 or DLG2, is a 576 amino acid protein belonging to the MAGUK family that exists as three alternatively spliced isoforms. MPP2 contains one guanylate kinase-like domain, a PDZ (DHR) domain, two L27 domains and a single SH3 domain. The gene encoding MPP2 maps to the same segment of human chromosome 17 as MPP3, with whom MMP2 likely shares similar function and common structural organization.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14168
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4355
Name Human MPP2 (aa 147-178) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D11Bwg0652e; discs large homolog 2; discs large, homolog 2; Dlg2; Dlgh2; MAGUK p55 subfamily member 2; membrane palmitoylated protein 2; membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2); Mpp2; p55 subfamily member of MAGUK family; palmitoylated membrane protein 2; Pals4; Protein MPP2; rCG_34691
Common Name MPP2
Gene Symbol Mpp2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.