Invitrogen™ Human MOXD1 (aa 130-225) Control Fragment Recombinant Protein

Product Code. 30195465

Brand: Invitrogen™ RP95050

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57381 (PA5-57381. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q6UVY6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26002
• Name: Human MOXD1 (aa 130-225) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3230402N08Rik; DBH-like monooxygenase protein 1; Dbhr; DBH-related protein; dJ248E1.1; dopamine-oxygenase; MNCb-5203; monooxygenase DBH like 1; monooxygenase X; monooxygenase, DBH-like 1; MOX; MOXD1; PRO5780; UNQ2493/PRO5780
• Common Name: MOXD1
• Gene Symbol: MOXD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DINDKSITDSTVRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVLSTALPYFDLVNQDVPIPNKDTTYWCQMFKIPVFQEKHHVIKVEPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining