Invitrogen™ Human MORN3 (aa 78-154) Control Fragment Recombinant Protein

Product Code. 30181101

Brand: Invitrogen™ RP97774

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58505 (PA5-58505. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q6PF18
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 283385
• Name: Human MORN3 (aa 78-154) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930438O03Rik; membrane occupation and recognition nexus repeat containing protein; MORN repeat containing 3; MORN repeat-containing protein 3; Morn3
• Common Name: MORN3
• Gene Symbol: MORN3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining