Invitrogen™ Human MORF4L2 (aa 9-90) Control Fragment Recombinant Protein

Product Code. 30203835

Brand: Invitrogen™ RP104641

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83212 (PA5-83212. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MORF4L2 is a protein coding gene. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones.

Specifications

• Accession Number: Q15014
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9643
• Name: Human MORF4L2 (aa 9-90) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410017O14Rik; Kiaa0026; Liver regeneration-related protein LRRG00119; LRRG00119; mKIAA0026; Morf4l2; MORFL2; MORF-related gene X; MORF-related gene x protein; mortality factor 4 like 2; mortality factor 4-like protein 2; MRGX; MSL3-2 protein; OTTHUMP00000023756; protein MSL3-2; RP5-1055C14.2; Sid 393; Sid393; Sid393p; transcription factor-like protein Mrgx
• Common Name: MORF4L2
• Gene Symbol: MORF4L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining