Invitrogen™ Human MORC2 (aa 888-1026) Control Fragment Recombinant Protein

Código de producto. 30202769

Marca: Invitrogen™ RP91359

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51390 (PA5-51390. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Exhibits a cytosolic function in lipogenesis, adipogenic differentiation, and lipid homeostasis by increasing the activity of ACLY, possibly preventing its dephosphorylation. May act as a transcriptional repressor. Down-regulates CA9 expression.

Especificaciones

• Accession Number: Q9Y6X9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22880
• Name: Human MORC2 (aa 888-1026) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8430403M08Rik; ATPase MORC2; ATPase MORC2A; CMT2Z; Kiaa0852; microrchidia 2 A; MORC family CW-type zinc finger 2; MORC family CW-type zinc finger protein 2; MORC family CW-type zinc finger protein 2 A; MORC2; Morc2a; ZCW3; ZCWCC1; zinc finger CW-type coiled-coil domain protein 1; zinc finger, CW-type with coiled-coil domain 1
• Common Name: MORC2
• Gene Symbol: MORC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TSECLRIEPDTTALSTNHETIDLLVQILRNCLRYFLPPSFPISKKQLSAMNSDELISFPLKEYFKQYEVGLQNLCNSYQSRADSRAKASEESLRTSERKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDELDAYIED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining