Invitrogen™ Human MON2 (aa 1018-1105) Control Fragment Recombinant Protein

Product Code. 30182186

Brand: Invitrogen™ RP97644

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58501 (PA5-58501. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be required for traffic between late Golgi and early endosomes.

Specifica

• Accession Number: Q7Z3U7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23041
• Name: Human MON2 (aa 1018-1105) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610528O22Rik; AW495628; Kiaa1040; mKIAA1040; MON2; MON2 homolog (S. cerevisiae); MON2 homolog (yeast); MON2 homolog, regulator of endosome-to-Golgi trafficking; MON2 regulator of endosome-to-Golgi trafficking; protein MON2 homolog; Protein SF21; RGD1308808; Sf21
• Common Name: MON2
• Gene Symbol: MON2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FDCLWLCLYAKLGELCVDPRPAVRKSAGQTLFSTIGAHGTLLQHSTWHTVIWKVLFHLLDRVRESSTTADKEKIESGGGNILIHHSRD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining