Invitrogen™ Human MOGAT3 (aa 226-333) Control Fragment Recombinant Protein

Product Code. 30194656

Brand: Invitrogen™ RP90064

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the formation of diacylglycerol from 2- monoacylglycerol and fatty acyl-CoA. Also able to catalyze the terminal step in triacylglycerol synthesis by using diacylglycerol and fatty acyl-CoA as substrates. Has a preference toward palmitoyl-CoA and oleoyl-CoA. May be involved in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes.

Specifications

• Accession Number: Q86VF5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 346606
• Name: Human MOGAT3 (aa 226-333) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2-acylglycerol O-acyltransferase 3; acyl coenzyme A:monoacylglycerol acyltransferase 3; acyl-CoA:monoacylglycerol acyltransferase 3; DC7; DGAT2L2; DGAT2L7; Diacylglycerol acyltransferase 2-like protein 7; diacylglycerol O-acyltransferase candidate 7; hDC7; MGAT3; MOGAT3; Monoacylglycerol O-acyltransferase 3; UNQ9383/PRO34208
• Common Name: MOGAT3
• Gene Symbol: MOGAT3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESCGVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining