missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197416

Invitrogen™ Human MOGAT1 (aa 120-182) Control Fragment Recombinant Protein

Codice prodotto. 30197416
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
Questo articolo non è restituibile. Consulta la politica di reso

Codice prodotto. 30197416

missing translation for 'mfr': Invitrogen™ RP109844

Please to purchase this item. Need a web account? Register with us today!

Questo articolo non è restituibile. Consulta la politica di reso

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145135 (PA5-145135. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine.
TRUSTED_SUSTAINABILITY

Specifica

Accession Number Q96PD6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 116255
Name Human MOGAT1 (aa 120-182) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610030A14Rik; 1110064N14Rik; 2-acylglycerol O-acyltransferase 1; acyl CoA:monoacylglycerol acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1; DC2; DGAT2L; Dgat2l1; Diacylglycerol acyltransferase 2-like protein 1; diacylglycerol O-acyltransferase 2 like 1; diacylglycerol O-acyltransferase 2-like 1; diacylglycerol O-acyltransferase candidate 2; hDC2; LOW QUALITY PROTEIN: 2-acylglycerol O-acyltransferase 1; mDC2; MGAT1; Mogat1; Monoacylglycerol O-acyltransferase 1; putative monoacylglycerol acyltransferase 1; WI1-2612I11.1
Common Name MOGAT1
Gene Symbol MOGAT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNIS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vedi altri risultati Mostra meno risultati
Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato