Invitrogen™ Human MOGAT1 (aa 120-182) Control Fragment Recombinant Protein

Product Code. 30197416

Brand: Invitrogen™ RP109844

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145135 (PA5-145135. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine.

Specifications

• Accession Number: Q96PD6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116255
• Name: Human MOGAT1 (aa 120-182) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610030A14Rik; 1110064N14Rik; 2-acylglycerol O-acyltransferase 1; acyl CoA:monoacylglycerol acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1; DC2; DGAT2L; Dgat2l1; Diacylglycerol acyltransferase 2-like protein 1; diacylglycerol O-acyltransferase 2 like 1; diacylglycerol O-acyltransferase 2-like 1; diacylglycerol O-acyltransferase candidate 2; hDC2; LOW QUALITY PROTEIN: 2-acylglycerol O-acyltransferase 1; mDC2; MGAT1; Mogat1; Monoacylglycerol O-acyltransferase 1; putative monoacylglycerol acyltransferase 1; WI1-2612I11.1
• Common Name: MOGAT1
• Gene Symbol: MOGAT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNIS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining