Invitrogen™ Human MOCS2 (aa 6-73) Control Fragment Recombinant Protein

Product Code. 30209492

Brand: Invitrogen™ RP96916

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58055 (PA5-58055. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits.

Specifications

• Accession Number: O96007, O96033
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4338
• Name: Human MOCS2 (aa 6-73) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI415403; HAMAP-Rule:MF_03052}; MCBPE; MOCO1; MOCO1-A; MOCO1-B; MOCODB; Mocs2; mocs2 {ECO:0000255; MOCS2A; MOCS2B; MOCS2B {ECO:0000255; molybdenum cofactor; molybdenum cofactor biosynthesis protein E; molybdenum cofactor synthesis 2; molybdenum cofactor synthesis protein 2 large subunit; molybdenum cofactor synthesis protein 2 large subunit {ECO:0000255; Molybdenum cofactor synthesis protein 2 small subunit; Molybdenum cofactor synthesis protein 2 A; Molybdenum cofactor synthesis protein 2 B; molybdenum cofactor synthesis protein 2 B {ECO:0000255; molybdopterin synthase catalytic subunit; molybdopterin synthase catalytic subunit {ECO:0000255; molybdopterin synthase catalytic subunit; molybdopterin synthase sulfur carrier subunit; molybdopterin synthase small and large subunit; molybdopterin synthase sulfur carrier subunit; Molybdopterin-synthase large subunit; Molybdopterin-synthase small subunit; MPT synthase large subunit; MPTS; Sulfur carrier protein MOCS2A
• Common Name: MOCS2
• Gene Symbol: MOCS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining