Invitrogen™ Human MOCS1 (aa 98-176) Control Fragment Recombinant Protein

Código de producto. 30206206

Marca: Invitrogen™ RP103319

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63532 (PA5-63532. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MONDOA forms heterodimers with MLX (MIM 602976) that can bind to and activate transcription from CACGTG E boxes.

Especificaciones

• Accession Number: Q9NZB8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4337
• Name: Human MOCS1 (aa 98-176) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110045D15Rik; AI043170; AW536397; bHLHe36; Cell migration-inducing gene 11 protein; Cyclic pyranopterin monophosphate synthase; GTP 3',8-cyclase; MIG11; migration-inducing gene 11 protein; MIR; Mlx interactor; MOCOD; MOCODA; MOCS1; MOCS1A enzyme; molybdenum cofactor biosynthesis protein 1; Molybdenum cofactor biosynthesis protein A; Molybdenum cofactor biosynthesis protein C; molybdenum cofactor synthesis 1; molybdenum cofactor synthesis-step 1 protein A-B; molybdenum cofactor synthesis-step 1 proteins A and B; MONDOA
• Common Name: MOCS1
• Gene Symbol: MOCS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KANLLTTEEILTLARLFVKEGIDKIRLTGGEPLIRPDVVDIVAQLQRLEGLRTIGVTTNGINLARLLPQLQKAGLSAIN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining