Invitrogen™ Human MMRN1 (aa 698-784) Control Fragment Recombinant Protein

Product Code. 30197925

Brand: Invitrogen™ RP96663

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57392 (PA5-57392. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Multimerin-1, also known as MMRN1, EMILIN-4 or ECM (endothelial cell multimerin), is a 1,228 amino acid secreted protein that contains one C1q domain, one EMI domain and one EGF-like domain. Synthesized in megakaryocytes and endothelial cells and present in liver, lung and placenta, Multimerin-1 exists as a multimeric structure composed of varying disulfide-linked multimers and functions as a carrier protein for platelet factors (specifically platelet factor V), playing a role in the stabilization and storage of factor V in platelets. In addition, Multimerin-1 acts as a ligand for select Integrins and may participate in extracellular matrix adhesion. Defects in the gene encoding Multimerin-1 that lead to Multimerin-1 deficiency are associated with autosomal dominant bleeding disorders due to platelet factor malfunction. Multiple isoforms of Multimerin-1 exist due to alternative splicing events.

Specifications

• Accession Number: Q13201
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22915
• Name: Human MMRN1 (aa 698-784) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 155 kDa platelet multimerin; 4921530G03Rik; ECM; Elastin microfibril interface located protein 4; elastin microfibril interfacer 4; EMILIN4; EMILIN-4; Endothelial cell multimerin; glycoprotein Ia*; GPIa*; MMRN; mmrn1; multimerin 1; multimerin-1; p155; p-155; Platelet glycoprotein Ia*
• Common Name: MMRN1
• Gene Symbol: MMRN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQFHRLND
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining