Invitrogen™ Human MMP2 (aa 445-575) Control Fragment Recombinant Protein

Product Code. 30180633

Brand: Invitrogen™ RP99358

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110648 (PA5-110648. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MMP (matrix metalloproteinase) are proteolytic enzymes capable of degrading connective tissue components. MMP have a common mode of activation, a conserved amino acid sequence in the putative metal binding-active site region, and are inhibited by specific tissue inhibitors of metalloproteinases (TIMPs). MMPa and TIMPs play a significant role in regulating angiogenesis. MMP2 is synthesized as a 631 amino acid proenzyme which is activated by cleavage of the first 80 amino acids, and contains the basic structure of propeptide, catalytic, and hemopexin domains. The matrix metalloproteinases (MMPs) are a family of at least eighteen secreted and membrane-bound zincendopeptidases. Collectively, these enzymes can degrade all the components of the extracellular matrix, including fibrillar and non-fibrillar collagens, fibronectin, laminin and basement membrane glycoproteins. In general, a signal peptide, a propeptide, and a catalytic domain containing the highly conserved zinc-binding site characterizes the structure of the MMPs. Functionally, MMP2 is involved in tissue remodeling. Mutations in MMP-2 gene have been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Two transcript variants encoding different isoforms of MMP-2 have been found.

Specifications

• Accession Number: P08253
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4313
• Name: Human MMP2 (aa 445-575) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 72 kDa gelatinase; 72 kDa type IV collagenase; 72 kDa type IV collagenase isoform a preproprotein; 72 kD gelatinase; 72 kD type IV collagenase; 72 kDa gelatinase; 72 kDa type IV collagenase; CLG 4 A; CLG4; CLG4A; Collagenase; collagenase type IV-A; endopeptidase; GelA; gelatinase A; Gelatinase alpha; Mat; matrix metallo protease; matrix metallopeptidase 2; matrix metallopeptidase 2 (gelatinase A, 72 kDa gelatinase, 72 kDa type IV collagenase); matrix metalloprotease 2; matrix metalloproteinase; matrix metalloproteinase 2; matrix metalloproteinase 2 (72 KDa type IV collagenase); matrix metalloproteinase 2 (gelatinase A, 72 kDa gelatinase, 72 kDa type IV collagenase); matrix metalloproteinase-2; matrix metalloproteinase-II; MMP; MMP2; MMP-2; MMP-2 protein; MMP-II; MMPs; MONA; neutrophil gelatinase; PEX; prepro-72 kDa matrix metalloproteinase; Progelatinase A; TBE1; TBE-1; wu:fa99h12; wu:fk89d01
• Common Name: MMP2
• Gene Symbol: MMP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining