Invitrogen™ Human MMP15 (aa 554-629) Control Fragment Recombinant Protein

Product Code. 30182108

Brand: Invitrogen™ RP98365

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MMPs are a group of enzymes involved in matrix degradation. Of the sixteen members of matrix metalloproteinase family ten exist in soluble form whereas MT-MMPs exist as integral membrane proteins. MT1-MMP, MT2-MMP, MT3-MMP also known as MMP14, MMP15, MMP16 respectively contain a C-terminal transmembrane domain anchoring them to the cell surface. They have an 8 amino acid insert in their catalytic domain. MT1-MMP cleaves progelatinase A (MMP-2) and progelatinase B to their active forms. MT2-MMP plays a minor role in activation of pro-MMP-2 to its active form in breast carcinomas. Coexpression of MT1-MMP and MT2-MMp in advanced stages of breast carcinomas is indicative of possible involvement of MT2-MMP in its metastasis.

Specifications

• Accession Number: P51511
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4324
• Name: Human MMP15 (aa 554-629) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI503551; matrix metallo protease; matrix metallopeptidase 15; matrix metallopeptidase 15 (membrane-inserted); matrix metalloproteinase 15; matrix metalloproteinase 15 (membrane-inserted); matrix metalloproteinase-15; Membrane type 2-MMP; membrane-type matrix metalloproteinase 2; Membrane-type-2 matrix metalloproteinase; MMP; Mmp15; MMP-15; MMPs; MT2MMP; MT2-MMP; MT-MMP 2; MTMMP2; SMCP-2
• Common Name: MMP15
• Gene Symbol: Mmp15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining