missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204279

Invitrogen™ Human MMP11 (aa 216-300) Control Fragment Recombinant Protein

Product Code. 30204279
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204279

Brand: Invitrogen™ RP103885

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111639 (PA5-111639. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Stromelysin, a member of the matrix metalloproteinase family, demonstrates wide substrate specificity with the ability to degrade proteoglycan, fibronectin, laminin, casein, and the nonhelical region of collagen. The stromelysin-3 (MMP-11) gene was originally identified on the basis that it is expressed specifically in stromal cells surrounding invasive breast carcinomas. MMP-11 is localized by in situ hybridization to the long arm of chromosome 22. The MMP-11 expression is found more specifically in malignant tumors than in benign ones.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number P24347
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4320
Name Human MMP11 (aa 216-300) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias matrix metallo protease; matrix metallopeptidase 11; matrix metallopeptidase 11 (stromelysin 3); Matrix metalloproteinase 11 (stromelysin 3); matrix metalloproteinase-11; MMP; MMP11; MMP-11; MMPs; SL-3; ST3; Stmy3; stromelysin III; stromelysin-3
Common Name MMP11
Gene Symbol Mmp11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.