Invitrogen™ Human MMP11 (aa 216-300) Control Fragment Recombinant Protein

Product Code. 30204279

Brand: Invitrogen™ RP103885

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111639 (PA5-111639. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Stromelysin, a member of the matrix metalloproteinase family, demonstrates wide substrate specificity with the ability to degrade proteoglycan, fibronectin, laminin, casein, and the nonhelical region of collagen. The stromelysin-3 (MMP-11) gene was originally identified on the basis that it is expressed specifically in stromal cells surrounding invasive breast carcinomas. MMP-11 is localized by in situ hybridization to the long arm of chromosome 22. The MMP-11 expression is found more specifically in malignant tumors than in benign ones.

Specifications

• Accession Number: P24347
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4320
• Name: Human MMP11 (aa 216-300) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: matrix metallo protease; matrix metallopeptidase 11; matrix metallopeptidase 11 (stromelysin 3); Matrix metalloproteinase 11 (stromelysin 3); matrix metalloproteinase-11; MMP; MMP11; MMP-11; MMPs; SL-3; ST3; Stmy3; stromelysin III; stromelysin-3
• Common Name: MMP11
• Gene Symbol: Mmp11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining