Invitrogen™ Human MMP1 (aa 21-168) Control Fragment Recombinant Protein

Product Code. 30212780

Brand: Invitrogen™ RP104548

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110690 (PA5-110690. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes a secreted enzyme which breaks down the interstitial collagens, types I, II, and III. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: P03956
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4312
• Name: Human MMP1 (aa 21-168) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 22 kDa interstitial collagenase; 27 kDa interstitial collagenase; CLG; CLGN; Collagenase; collagenase-like A; fibroblast collagenase; Interstitial collagenase; interstitial collagenase A; matrix metallo protease; matrix metallopeptidase 1; matrix metallopeptidase 1 (interstitial collagenase); matrix metallopeptidase 1 A; matrix metallopeptidase 1 A (interstitial collagenase); matrix metalloprotease 1; matrix metalloproteinase 1; matrix metalloproteinase 1 A (interstitial collagenase); Matrix metalloproteinase1; Matrix metalloproteinase-1; Matrix metalloproteinase-1 A; McolA; Mcol-A; MMP; MMP1; MMP-1; Mmp1a; MMP-1 A; MMPs
• Common Name: MMP1
• Gene Symbol: MMP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining