Invitrogen™ Human MMADHC (aa 98-193) Control Fragment Recombinant Protein

Product Code. 30212497

Brand: Invitrogen™ RP102772

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57991 (PA5-57991. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in cobalamin metabolism.

Specifications

• Accession Number: Q9H3L0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27249
• Name: Human MMADHC (aa 98-193) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010311D03Rik; AI314967; C2orf25; CblD; CL25022; HSPC161; likely ortholog of H. sapiens chromosome 2 open reading frame 25 (C2orf25); methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria; methylmalonic aciduria and homocystinuria type D homolog, mitochondrial; Methylmalonic aciduria and homocystinuria type D protein, mitochondrial; methylmalonic aciduria and homocystinuria, cblD type; Mmadhc; My011; protein C2orf25, mitochondrial
• Common Name: MMADHC
• Gene Symbol: MMADHC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLPDVLAEPLSSERHEFVMAQYVNEFQGNDAPVEQEINSAETYFESARVECAIQTCPELLRKDFESLFPEVANGKLMILTVTQKTKNDMTVWSEEV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining