Invitrogen™ Human MLSTD2 (aa 7-149) Control Fragment Recombinant Protein

Product Code. 30208220

Brand: Invitrogen™ RP90598

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53585 (PA5-53585. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MLSTD2 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.

Specifications

• Accession Number: Q8WVX9
• Concentration: 3.50 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84188
• Name: Human MLSTD2 (aa 7-149) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2600011M19Rik; 2900034E22Rik; 3732409C05Rik; AI850429; FAR1; fatty acyl CoA reductase 1; fatty acyl-CoA reductase 1; male sterility domain containing 2; male sterility domain-containing protein 2; MLSTD2; PFCRD; SDR10E1; short chain dehydrogenase/reductase family 10 E, member 1; UNQ2423/PRO4981
• Common Name: MLSTD2
• Gene Symbol: FAR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHCAATVRFNENLRDAVQLNVIATRQLILLAQQMKNLEVFM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining