Invitrogen™ Human MLLT1 (aa 142-260) Control Fragment Recombinant Protein

Product Code. 30209502

Brand: Invitrogen™ RP102514

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83183 (PA5-83183. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Chromosome band 11q23 is the site of translocations in myeloid and lymphoid acute leukemias, pediatric leukemias, and treatment-induced secondary acute myelogenous leukemia. The translocation breakpoints cluster in a restricted region of the HRX gene resulting in chimeric genes that encode an N-terminal portion of Hrx fused to various partner proteins. Myeloid/lymphoid or mixed-lineage leukemia translocated to 1 (MLLT1) is a nuclear protein with transcriptional transactivation properties that is fused to Hrx in t(11;19) leukemias. The minimal MLLT1 sequence required for transcription activation was narrowed to the C-terminal 90 amino acids.

Specifications

• Accession Number: Q03111
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4298
• Name: Human MLLT1 (aa 142-260) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA407901; BAM11; CTC-503J8.6; ENL; ENL/MLL fusion; leukemia-associated protein MLLT1; LTG19; MLL/ENL fusion protein; MLLT1; MLLT1 super elongation complex subunit; MLLT1, super elongation complex subunit; MLLT1/MLL fusion; myeloid/lymphoid or mixed lineage leukemia translocation to 1 homolog; myeloid/lymphoid or mixed lineage-leukemia translocation to 1 homolog; myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocated to, 1; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 1; myeloid/lymphoid or mixed-lineage leukemia; translocated to, 1; protein ENL; trithorax; YEATS domain-containing protein 1; YEATS1
• Common Name: MLLT1
• Gene Symbol: MLLT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining