Invitrogen™ Human MLCK (aa 165-249) Control Fragment Recombinant Protein

Product Code. 30201017

Brand: Invitrogen™ RP108263

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84926 (PA5-84926. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MLCK (MLCK2), now also known as MYLK3, is of the myosin regulatory light chain kinases which facilitates muscle contraction. MLCK, a member of the Ser/Thr protein kinase family, is responsible for smooth muscle contraction via phosphorylation of a specific serine in the N-terminus of myosin light chains (MLC), an event that facilitates myosin interaction with actin filaments. It is a central determinant in the development of vascular permeability and tissue edema formation. In the nervous system it has been shown to control the growth initiation of astrocytic processes in culture and to participate in transmitter release at synapses formed between cultured sympathetic ganglion cells. MLCK acts as a critical participant in signaling sequences that result in fibroblast apoptosis. Smooth muscle and non-muscle isozymes are expressed in a wide variety of adult and fetal tissues and in cultured endothelium with qualitative expression appearing to be neither tissue- nor development-specific. Non-muscle isoform 2 is the dominant splice variant expressed in various tissues. The Telokin isoform, which binds calmodulin, has been found in a wide variety of adult and fetal tissues. MLCK is probably down-regulated by phosphorylation. The protein contains 1 fibronectin type III domain and 9 immunoglobulin-like C2-type domains.

Specifications

• Accession Number: Q32MK0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91807
• Name: Human MLCK (aa 165-249) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: caMLCK; cardiac MLCK; cardiac-MLCK; cardiac-MyBP-C associated Ca/CaM kinase; cardiac-MyBP-C-associated Ca/CaM kinase; cardiac-specific myosin light chain kinase; D830007F02Rik; MLC kinase; MLCK; MLCK2; Mylk3; Myosin light chain kinase 3; putative myosin light chain kinase 3; putative myosin light chain kinase 3; myosin light chain kinase 3; RGD1305801
• Common Name: MLCK
• Gene Symbol: MYLK3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGTAERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHLPLPTKVEAK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining