Invitrogen™ Human MKS1 (aa 357-443) Control Fragment Recombinant Protein

Product Code. 30210921

Brand: Invitrogen™ RP93226

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54515 (PA5-54515. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene localizes to the basal body and is required for formation of the primary cilium in ciliated epithelial cells. Mutations in this gene result in Meckel syndrome type 1 and in Bardet-Biedl syndrome type 13. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9NXB0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54903
• Name: Human MKS1 (aa 357-443) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AK190930; B8d3; BBS13; LOW QUALITY PROTEIN: Meckel syndrome type 1 protein; Meckel syndrome type 1 protein; Meckel syndrome type 1 protein homolog; Meckel syndrome, type 1; MES; MKS; MKS transition zone complex subunit 1; Mks1; POC12; POC12 centriolar protein homolog
• Common Name: MKS1
• Gene Symbol: MKS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TCTTKSLAMDKVAHFSYPFTFEAFFLHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining