Invitrogen™ Human MKP-1 (aa 311-359) Control Fragment Recombinant Protein

Product Code. 30199833

Brand: Invitrogen™ RP105479

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84818 (PA5-84818. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation.

Specifications

• Accession Number: P28562
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1843
• Name: Human MKP-1 (aa 311-359) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3 ch134; 3 CH134/CL100 PTPase; CL 100; CL100; dual specificity phosphatase 1; dual specificity protein phosphatase 1; Dual specificity protein phosphatase hVH1; DUS1; DUSP1; EC 3.1.3.16; EC 3.1.3.48; erp; HVH1; MAP kinase phosphatase 1; MAP kinase phosphatase-1; mitogen-activated protein (MAP) kinase phosphatase-1; mitogen-activated protein kinase phosphatase 1; mitogen-activated protein kinase phosphatase-1; MKP1; mkp-1; oxidative stress-inducible protein tyrosine phosphatase; protein tyrosine phosphatase non-receptor type 16; protein tyrosine phosphatase, non-receptor type 16; protein-tyrosine phosphatase 3 CH134; Protein-tyrosine phosphatase CL100; protein-tyrosine phosphatase ERP; Protein-tyrosine phosphatase non-receptor type 16; PTPN10; Ptpn16; serine/threonine specific protein phosphatase; U19515; VH1
• Common Name: MKP-1
• Gene Symbol: Dusp1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining