Invitrogen™ Human MKNK2 (aa 399-446) Control Fragment Recombinant Protein

Product Code. 30205348

Brand: Invitrogen™ RP106497

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111659 (PA5-111659. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Map kinase-interacting kinases (MKNK1 and MKNK2) are activated by Map kinases, regulate protein synthesis by phosphroylation eIF4E on Ser209, and may contribute to tumorigenesis. Overexpression of Mnk2 results in increased phosphorylation of endogenous eIF-4E, showing that it can act as an eIF-4E kinase in vivo. Mnk2 may play a role in the response to environmental stress and cytokines. Expression of active mutants of MNK1 and MNK2 in 293 cells diminishes cap-dependent translation relative to cap-independent translation in a transient reporter assay. Human Mnk2 is homologous to murine Mnk2 (approximately 94% identical) and human Mnk1 (71% identical). In vitro phosphorylation studies show that Mnk2 is a significantly better substrate than Mnk1 for extracellular signal-regulated kinase 2 (Erk2), p38MAPKalpha, and p38MAPKbeta.

Specifications

• Accession Number: Q9HBH9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2872
• Name: Human MKNK2 (aa 399-446) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010016G11Rik; G protein-coupled receptor kinase 7; GPRK7; MAP kinase interacting serine/threonine kinase 2; MAP kinase signal-integrating kinase 2; MAP kinase-interacting serine/threonine kinase 2; MAP kinase-interacting serine/threonine-protein kinase 2; MAP kinase-interacting serine/threonine-protein kinase 2; LOW QUALITY PROTEIN: MAP kinase-interacting serine/threonine-protein kinase 2; MAPK interacting serine/threonine kinase 2; MAPK signal-integrating kinase 2; Mknk2; MNK2
• Common Name: MKNK2
• Gene Symbol: Mknk2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AIAMNRQLAQHDEDLAEEEAAGQGQPVLVRATSRCLQLSPPSQSKLAQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining