Invitrogen™ Human MKL2 (aa 136-273) Control Fragment Recombinant Protein

Product Code. 30202995

Brand: Invitrogen™ RP89421

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Serum response factor (SRF) is a transcription factor that binds the serum response element (SRE), a sequence that mediates the transient response of many cellular genes to growth stimulation. SRF regulates the transient response of several muscle genes in response to growth factors and recruits accessory myogenic factors to activate these muscle genes. SRF is required for the formation of vertebrate mesoderm leading to the origin of the cardiovascular system. Myocardin, in association with SRF in cardiac muscle cells, activates cardiac muscle promoters. Myocardin-related transcription factors A and B (MRTF-A and MRTF-B) interact with SRF and act as stimulators for its transcriptional activity. MRTF-B is crucial for skeletal myogenic differentiation.

Specifications

• Accession Number: Q9ULH7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57496
• Name: Human MKL2 (aa 136-273) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CTA-276F8.1; ENSMUSG00000075401; gene trap insertion site 4-1; Gt4-1; KIAA1243; Megakaryoblastic leukemia 2; megakaryoblastic leukemia 2 protein; mKIAA1243; MKL/myocardin like 2; MKL/myocardin-like 2; MKL/myocardin-like protein 2; MKL1/myocardin like 2; Mkl2; Mrtfb; MRTF-B; myocardin related transcription factor B; myocardin-related transcription factor B; myocardin-related transcription factor B; MKL/myocardin-like protein 2; NPD001; RGD1560833
• Common Name: MKL2
• Gene Symbol: Mkl2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining