Invitrogen™ Human MKK7 Control Fragment Recombinant Protein

Product Code. 30205418

Brand: Invitrogen™ RP102113

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase family. This kinase specifically activates MAPK8/JNK1 and MAPK9/JNK2, and this kinase itself is phosphorylated and activated by MAP kinase kinases including MAP3K1/MEKK1, MAP3K2/MEKK2, MAP3K3/MEKK5, and MAP4K2/GCK. This kinase is involved in the signal transduction mediating the cell responses to proinflammatory cytokines, and environmental stresses. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found, but only one transcript variant has been supported and defined.

Specifications

• Accession Number: O14733
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5609
• Name: Human MKK7 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2; 5930412N11Rik; c-Jun N-terminal kinase kinase 2; Dual specificity mitogen-activated protein kinase kinase 7; EMBL:AAX61178.1}; JN; JNK kinase 2; JNK-activating kinase 2; JNKK; JNKK 2; Jnkk2; MAP kinase kinase 7; MAP2K4; map2k7; map2k7 {ECO:0000312; MAPK/ERK kinase 4; MAPK/ERK kinase 7; MAPKK 4; MAPKK 7; MAPKK7; MEK; MEK 4; MEK 7; Mek7; mitogen activated protein kinase kinase 7; mitogen-activated protein kinase kinase 7; Mkk7; PRKMK7; protein kinase, mitogen activated, kinase 7; SAPK kinase 1; SAPK kinase 4; SAPK/ERK kinase 1; SAPKK1; SAPKK-1; SAPKK4; SAPKK-4; SEK1; sek2; SKK4; Stress-activated protein kinase kinase 4
• Common Name: MKK7
• Gene Symbol: MAP2K7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETMEV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining