Invitrogen™ Human MIXL1 (aa 88-228) Control Fragment Recombinant Protein

Product Code. 30203772

Brand: Invitrogen™ RP105701

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64903 (PA5-64903. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MIXL1 is a novel human Mix-like homeobox gene. In normal hematopoiesis, its expression appears to be restricted to immature B- and T-lymphoid cells.

Specifications

• Accession Number: Q9H2W2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83881
• Name: Human MIXL1 (aa 88-228) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: hMix; Homeobox protein MIXL1; homeodomain protein MIX; MILD1; MIX; Mix paired-like homeobox; Mix paired-like homeobox 1; mix0.1 homeobox-like protein; Mi x 1 homeobox-like 1 (Xenopus laevis); MI x 1 homeobox-like protein 1; MIXL; Mixl1; Mix-like homeobox protein 1; Mm1; mMix; Mml
• Common Name: MIXL1
• Gene Symbol: MIXL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining