Invitrogen™ Human Mitofilin (aa 645-730) Control Fragment Recombinant Protein

Product Code. 30201359

Brand: Invitrogen™ RP102700

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitofilin is a transmembrane protein of the inner mitochondrial membrane and it is associated with a large multimeric protein complex of about 1200 kDa. Mitofilin has critical functions in mitochondrial morphology and mitochondrial fusion and fission, specifically in the formation of tubular cristae and cristae junctions. Abnormal mitochondrial morphology has been implicated in many human diseases such as myopathy, cardiomyopathy, rhabdomyosarcoma and Whartin's tumor.

Specifications

• Accession Number: Q16891
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10989
• Name: Human Mitofilin (aa 645-730) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700082C19Rik; cell proliferation-inducing gene 4/52 protein; cell proliferation-inducing protein 52; D830041H16Rik; EMBL:AAI05842.1, ECO:0000312; EMBL:AAI05842.1}; HMP; Immt; immt {ECO:0000312; IMMT antibody; inner membrane mitochondrial protein; inner membrane protein, mitochondrial; inner membrane protein, mitochondrial (mitofilin); MGC133830 protein; MIC60; MICOS complex subunit Mic60; MINOS2; mitochondrial inner membrane organizing system 2; mitochondrial inner membrane protein; mitochondrial inner membrane protein {ECO:0000250; Mitofilin; mitofilin {ECO:0000250; motor protein; P87; p87/89; p87/89 antibody; P89; PIG4; PIG52; proliferation-inducing gene 4; RGD:1310684}; UniProtKB:Q8CAQ8, ECO:0000312; UniProtKB:Q8CAQ8}
• Common Name: Mitofilin
• Gene Symbol: IMMT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VAMIDETRNSLYQYFLSYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining