Invitrogen™ Human MiTF (aa 387-525) Control Fragment Recombinant Protein

Product Code. 30200636

Brand: Invitrogen™ RP100736

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82074 (PA5-82074. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mi is a basic helix-loop-helix-leucine zipper (b-HLH-ZIP) transcription factor implicated in pigmentation, mast cells and bone development. The mutation of Mi causes Waardenburg Syndrome type II in humans. In mice, a profound loss of pigmented cells in the skin eye and inner ear results, as well as osteopetrosis and defects in natural killer and mast cells. There are two known isoforms of Mi differing by 66 amino acids at the NH2 terminus. Shorter forms are expressed in melanocytes and run as two bands at 52 kDa and 56 kDa, while the longer Mi form runs as a cluster of bands at 60-70 kDa in osteoclasts and in B16 melonoma cells (but not other melanoma cell lines), as well as mast cells and heart.

Specifications

• Accession Number: O75030
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4286
• Name: Human MiTF (aa 387-525) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BCC2; Bhlhe32; black eyed white; bw; Class E basic helix-loop-helix protein 32; CMM8; Gsfbcc2; melanocyte inducing transcription factor; melanogenesis associated transcription factor; mi; microphtalmia-associated transcription factor; microphthalmia; microphthalmia associated transcription factor isoform M-; microphthalmia transcription factor; microphthalmia-associated transcription factor; microphthalmia-associated transcription factor A; microphthalmia-associated transcription factor isoform H; microphthalmia-associated transcription factor isoform H protein; microphthalmia-associated transcription factor Trnc-1; microphthalmia-associated transcription factor Trnc-2; microphthalmia-associated transcription factor variant 1; microphthalmia-associated transcription factor variant 2; microphthalmia-associated transcription factor variant 3; microphthalmia-associated transcription factor variant MITF-M(+); MITF; MITF-H; MITF-M; MITF-M-; transcription factor, isoform 7; vit; Vitiligo; Wh; WS2; WS2A
• Common Name: MiTF
• Gene Symbol: MITF
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining