missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MiTF (aa 387-525) Control Fragment Recombinant Protein

Product Code. 30200636
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30200636 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30200636 Supplier Invitrogen™ Supplier No. RP100736

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82074 (PA5-82074. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mi is a basic helix-loop-helix-leucine zipper (b-HLH-ZIP) transcription factor implicated in pigmentation, mast cells and bone development. The mutation of Mi causes Waardenburg Syndrome type II in humans. In mice, a profound loss of pigmented cells in the skin eye and inner ear results, as well as osteopetrosis and defects in natural killer and mast cells. There are two known isoforms of Mi differing by 66 amino acids at the NH2 terminus. Shorter forms are expressed in melanocytes and run as two bands at 52 kDa and 56 kDa, while the longer Mi form runs as a cluster of bands at 60-70 kDa in osteoclasts and in B16 melonoma cells (but not other melanoma cell lines), as well as mast cells and heart.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75030
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4286
Name Human MiTF (aa 387-525) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BCC2; Bhlhe32; black eyed white; bw; Class E basic helix-loop-helix protein 32; CMM8; Gsfbcc2; melanocyte inducing transcription factor; melanogenesis associated transcription factor; mi; microphtalmia-associated transcription factor; microphthalmia; microphthalmia associated transcription factor isoform M-; microphthalmia transcription factor; microphthalmia-associated transcription factor; microphthalmia-associated transcription factor A; microphthalmia-associated transcription factor isoform H; microphthalmia-associated transcription factor isoform H protein; microphthalmia-associated transcription factor Trnc-1; microphthalmia-associated transcription factor Trnc-2; microphthalmia-associated transcription factor variant 1; microphthalmia-associated transcription factor variant 2; microphthalmia-associated transcription factor variant 3; microphthalmia-associated transcription factor variant MITF-M(+); MITF; MITF-H; MITF-M; MITF-M-; transcription factor, isoform 7; vit; Vitiligo; Wh; WS2; WS2A
Common Name MiTF
Gene Symbol MITF
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.