missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197897

Invitrogen™ Human MINK1 (aa 695-758) Control Fragment Recombinant Protein

Product Code. 30197897
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197897

Brand: Invitrogen™ RP100408

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84283 (PA5-84283. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MINK1 is a serine/threonine kinase belonging to the germinal center kinase (GCK) family. The protein is structurally similar to the kinases that are related to NIK and may belong to a distinct subfamily of NIK-related kinases within the GCK family. Studies of the mouse homolog indicate an up-regulation of expression in the course of postnatal mouse cerebral development and activation of the cJun N-terminal kinase (JNK) and the p38 pathways.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N4C8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 50488
Name Human MINK1 (aa 695-758) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B55; FLJ18426; FLJ38123; FLJ94103; GCK family kinase MiNK; hMINK; hMINKbeta; ISK; JLNS; JLNS2; LQT2/5; LQT5; Map4k6; MAPK/ERK kinase kinase kinase 6; MEK kinase kinase 6; MEKKK 6; MGC33114; MINK; Mink 1; Mink 2; MINK1; misshapen like kinase 1; misshapen/NIK-related kinase; Misshapen/NIKs-related kinase; misshapen-like kinase 1; misshapen-like kinase 1 (zebrafish); mitogen-activated protein kinase kinase kinase kinase 6; Yeast Sps1/Ste20-related kinase 2; Ysk2; ZC3
Common Name MINK1
Gene Symbol MINK1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.