Invitrogen™ Human MINA53 (aa 1-148) Control Fragment Recombinant Protein

Product Code. 30212541

Brand: Invitrogen™ RP89697

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MINA is nuclear localized, myc-inducible protein that is thought to play a role in mammalian cell proliferation. Treatment of cancer cells lines such as the colon cancer cell line SW680 with siRNA against MINA inhibits cell growth, demonstrating that MINA may be a potential therapeutic target. MINA regulates several genes related to cell adhesion and metabolism that have also been shown to be regulated by c-Myc, but also regulates other genes whose expression are not modulated by c-Myc such as EGFR, IL-6 and HGF. MINA has also been found to act as a repressor to IL-4 expression in T cells, indicating that it may also play a role in T cell differentiation and genetic variation in T helper type 2 bias.

Specifications

• Accession Number: Q8IUF8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84864
• Name: Human MINA53 (aa 1-148) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810047J07Rik; 2410057H13Rik; 3830408E23Rik; 60 S ribosomal protein L27a histidine hydroxylase; AI449204; Bifunctional lysine-specific demethylase and histidyl-hydroxylase MINA; DKFZp762O1912; FLJ14393; histone lysine demethylase MINA; MDIG; mina; mina {ECO:0000312; Mina53; Mina-53; mineral dust induced gene protein; mineral dust-induced gene protein; MYC induced nuclear antigen; myc-induced nuclear antigen; myc-induced nuclear antigen, 53 kDa; NO52; Nucleolar protein 52; Protein mina53; RGD:708521}; Ribosomal oxygenase 2; Ribosomal oxygenase MINA; RIO x 2; ROX
• Common Name: MINA53
• Gene Symbol: RIOX2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDDPALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQPQRFKDELW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining