Invitrogen™ Human MIIP (aa 307-388) Control Fragment Recombinant Protein

Product Code. 30211324

Brand: Invitrogen™ RP94086

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60869 (PA5-60869. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MIIP inhibits glioma cells invasion and down-regulates adhesion-and motility-associated genes such as NFKB2 and ICAM1. MIIP exhibits opposing effects to IGFBP2 on cell invasion.

Specifications

• Accession Number: Q5JXC2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 60672
• Name: Human MIIP (aa 307-388) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA553001; AI853621; D4Wsu114e; IGFBP2-binding protein; IGFBP-2-Binding Protein, IIp45; Iip45; invasion inhibitory protein 45; invasion-inhibitory protein 45; migration and invasion inhibitory protein; migration and invasion-inhibitory protein; MIIP
• Common Name: MIIP
• Gene Symbol: MIIP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining