Invitrogen™ Human Mig-6 (aa 229-310) Control Fragment Recombinant Protein

Product Code. 30196857

Brand: Invitrogen™ RP94071

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110930 (PA5-110930. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ERRFI1 is a cytoplasmic protein whose expression is upregulated with cell growth (Wick et al., 1995). It shares significant homology with the protein product of rat gene-33, which is induced during cell stress and mediates cell signaling (Makkinje et al., 2000).

Specifications

• Accession Number: Q9UJM3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54206
• Name: Human Mig-6 (aa 229-310) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300002F13Rik; 33; AI788755; ERBB receptor feedback inhibitor 1; Errfi1; gene 33; Gene 33 polypeptide; GENE-33; MIG6; MIG-6; Mitogen-inducible gene 6 protein; mitogen-inducible gene 6 protein homolog; RALT; Receptor-associated late transducer; RGD1307599; Xxx
• Common Name: Mig-6
• Gene Symbol: Errfi1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRRWSAEVTSSTY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining