missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204790

Invitrogen™ Human MIER1 (aa 428-512) Control Fragment Recombinant Protein

Product Code. 30204790
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204790

Brand: Invitrogen™ RP106272

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65607 (PA5-65607. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The association of hMI-ER1 with Sp1 represents a novel mechanism for the negative regulation of Sp1 target promoters. Results demonstrate that alternate use of a facultative intron regulates the subcellular localization of hMI-ER1 proteins and this may have important implications for hMI-ER1 function in the regulation of transcription. Repressor activity is due to interaction and recruitment of a trichostatin A-sensitive histone deacetylase 1 (HDAC1).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N108
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57708
Name Human MIER1 (aa 428-512) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933425I22Rik; 5830411K19Rik; early response 1; er1; hMI-ER1; Kiaa1610; mesoderm induction early response 1 homolog; mesoderm induction early response 1 homolog (Xenopus laevis; mesoderm induction early response 1, transcriptional regulator; mesoderm induction early response protein 1; MIER1; MI-ER1; MIER1 transcriptional regulator; RGD1562337; RP5-944N15.1)
Common Name MIER1
Gene Symbol MIER1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRRVNSNGKESPGSSEFFQEAVSHGKFEELENTDD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.