Invitrogen™ Human MID1IP1 (aa 62-136) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30198393	100 μL	100µL

Product Code. 30198393 Supplier Invitrogen™ Supplier No. RP95456

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58552 (PA5-58552. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in the regulation of lipogenesis in liver. Up-regulates ACACA enzyme activity. Required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Involved in stabilization of microtubules.

Specifications

• Accession Number: Q9NPA3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 58526
• Name: Human MID1IP1 (aa 62-136) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110038L01Rik; FLJ10386; G12-like; gastrulation specific G12 homolog; gastrulation-specific G12-like protein; MID1 interacting G12-like protein; MID1 interacting protein 1; MID1 interacting protein 1 (gastrulation specific G12 homolog); Mid1 interacting protein 1 (gastrulation specific G12-like (zebrafish)); MID1 interacting protein 1 (gastrulation specific G12-like); mid1-interacting G12-like protein; Mid1-interacting protein 1; MID1IP1; mid1ip1 {ECO:0000250; Mig12; Protein STRAIT11499; Protein STRAIT11499 homolog; S14R; slap; spot 14-like androgen-inducible protein; spot 14-R; spot 14-related protein; STRAIT11499; THRSPL; UniProtKB:Q9CQ20}
• Common Name: MID1IP1
• Gene Symbol: MID1IP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining