Invitrogen™ Human MICU3 (aa 238-309) Control Fragment Recombinant Protein

Product Code. 30199003

Brand: Invitrogen™ RP93839

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55177 (PA5-55177. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role in mitochondrial calcium uptake. [UniProt]

Specifications

• Accession Number: Q86XE3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 286097
• Name: Human MICU3 (aa 238-309) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: calcium uptake protein 3, mitochondrial; EF hand domain family A2; EF hand domain family, member A2; EFHA2; EF-hand domain family, member A2; EF-hand domain-containing family member A2; MICU3; mitochondrial calcium uptake family member 3; mitochondrial calcium uptake family, member 3; mitochondrial uptake family, member 3
• Common Name: MICU3
• Gene Symbol: MICU3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKRAMLRLQLYGYHSPTNSVLKTDAEELVSRS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining