Invitrogen™ Human MICS1 (aa 33-83) Control Fragment Recombinant Protein

Product Code. 30194186

Brand: Invitrogen™ RP104182

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63978 (PA5-63978. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for the mitochondrial tubular network and cristae organization. Involved in apoptotic release of cytochrome c.

Specifications

• Accession Number: Q9H3K2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27069
• Name: Human MICS1 (aa 33-83) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1010001P14Rik; C77840; dermal papilla-derived protein 2; DERP2; DKFZp566C0746; FLJ26584; GHITM; growth hormone inducible transmembrane protein; growth hormone-inducible transmembrane protein; growth hormone-inducible transmembrane protein-like protein; HSPC282; MICS1; mitochondrial morphology and cristae structure 1; My021; PTD010; similar to Dermal papilla derived protein 2; Tmbim5; transmembrane BAX inhibitor motif containing 5; transmembrane BAX inhibitor motif-containing protein 5; UNQ244/PRO281
• Common Name: MICS1
• Gene Symbol: GHITM
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining