Invitrogen™ Human MICB (aa 331-381) Control Fragment Recombinant Protein

Product Code. 30212701

Brand: Invitrogen™ RP107349

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66698 (PA5-66698. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MICB encodes the highly polymorphic MHC (HLA) class I chain-related gene B. The protein product is expressed on the cell surface. It is thought that MICB functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. MICB is broadly recognized by NK cells and T cells with NKG2D receptor on their surface. The complex NKG2D-MICB results in MICB expressing cytolytic T cells and NK cells against epithelial tumor cells.

Specifications

• Accession Number: Q29980
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4277
• Name: Human MICB (aa 331-381) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: MHC class I chain-related protein B; MHC class I mic-B antigen; MHC class I polypeptide-related sequence B; MHC class I-like located near the LRC, 2; MHC class I-like molecule PERB11.2-IMX; MHC I like leukocyte 2; MICB; MIC-B; Mill2; Mill2 gene for MHC class I-like located near the LRC, 2, exon 3, partial cds, strain:LEW0.1 Lm1; PERB11.2; sMICB; soluble MICB; stress inducible class I homolog
• Common Name: MICB
• Gene Symbol: MICB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining