Invitrogen™ Human MICALL1 (aa 755-855) Control Fragment Recombinant Protein

Product Code. 30205866

Brand: Invitrogen™ RP106364

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65689 (PA5-65689. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MICALL1 may be a cytoskeletal regulator.

Specifications

• Accession Number: Q8N3F8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85377
• Name: Human MICALL1 (aa 755-855) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KIAA1668; L23MRP; L23mt; MICAL like 1; MICALL1; MICAL-L1; MICAL-like 1; MICAL-like protein 1; MIRAB13; Molecule interacting with Rab13; MRP-L23; RPL23; RPL23L
• Common Name: MICALL1
• Gene Symbol: MICALL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining