Invitrogen™ Human MICAL2 (aa 592-718) Control Fragment Recombinant Protein

Product Code. 30202392

Brand: Invitrogen™ RP88764

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56474 (PA5-56474. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MICALs (Molecules Interacting with CasL) are atypical multidomain flavoenzymes with diverse cellular functions. There are three known isoforms, MICAL1, MICAL2 and MICAL3, as well as the MICAL-like proteins MICAL-L1 and MICAL-L2. MICAL2 has three conserved domains: an N-terminal flavin adenine dinucleotide (FAD) binding domain, a calponin homology (CH) domain and a Lin11, Isl-1 and Mec-3 (LIM) domain. It has been demonstrated that MICAL2 could regulate actin stress fibers and is required for normal actin organization. In addition, MICAL2-PV, a novel splicing variants of MICAL2, has been reported to be involved in cancer progression of prostate cancer.

Specifications

• Accession Number: O94851
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9645
• Name: Human MICAL2 (aa 592-718) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: [F-actin]-monooxygenase MICAL2; 5330438E18Rik; 9530064J02; flavoprotein oxidoreductase MICAL2; Kiaa0750; Mical2; MICAL-2; MICAL2PV1; MICAL2PV2; microtubule associated monooxygenase, calponin and LIM domain containing 2; microtubule associated monoxygenase, calponin and LIM domain containing 2; mKIAA0750; mMical2; molecule interacting with CasL protein 2; protein MICAL-2; protein-methionine sulfoxide oxidase MICAL2; RGD1311773
• Common Name: MICAL2
• Gene Symbol: Mical2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PVTTGKEMASAQEPDKLSMVMYLSKFYELFRGTPLRPVDSWRKNYGENADLSLAKSSISNNYLNLTFPRKRTPRVDGQTGENDMNKRRRKGFTNLDEPSNFSSRSLGSNQECGSSKEGGNQNKVKSM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining