Invitrogen™ Human MICAL1 (aa 816-908) Control Fragment Recombinant Protein

Product Code. 30202897

Brand: Invitrogen™ RP102565

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56387 (PA5-56387. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be a cytoskeletal regulator that connects NEDD9 to intermediate filaments.

Specifications

• Accession Number: Q8TDZ2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64780
• Name: Human MICAL1 (aa 816-908) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: [F-actin]-monooxygenase MICAL1; CasL interacting molecule MICAL; MICAL; MICAL1; MICAL-1; microtubule associated monooxygenase, calponin and LIM domain containing 1; microtubule associated monoxygenase, calponin and LIM domain containing 1; mMical1; molecule interacting with CasL protein 1; NEDD9 interacting protein with calponin homology and LIM domains; NEDD9-interacting protein with calponin homology and LIM domains; NICAL; protein-methionine sulfoxide oxidase MICAL1
• Common Name: MICAL1
• Gene Symbol: MICAL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSSLNLTPDPEMEPPPKPPRSCSALARHALESSFVGWGLPVQSPQALVAMEKEEKESPFSSEEEEEDVPLDSDVEQALQTFAKTSGTMNNYPT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining