missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MGST2 (aa 31-63) Control Fragment Recombinant Protein

Product Code. 30209796
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209796

Brand: Invitrogen™ RP90627

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52732 (PA5-52732. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MGST2 (Microsomal glutathione S-transferase 2) is a 147 amino acid protein encoded by the human gene MGST2. MGST2 can catalyze the production of LTC4 (leukotriene C4) from LTA4 (leukotriene A4) and reduced glutathione. It can also catalyze the conjugation of 1-chloro-2,4-dinitrobenzene with reduced glutathione. MSGT2 is a multi-pass membrane protein found as a homodimer. MGST2 belongs to the MAPEG family and is expressed in liver, spleen, skeletal muscle, heart, adrenals, pancreas, prostate, testis, fetal liver, and fetal spleen. It has very low expression in lung, brain, placenta and bone marrow. Also, MGST2 is the only GST expressed in human umbilical vein endothelial cells (HUVECs).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99735
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4258
Name Human MGST2 (aa 31-63) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FLJ27438; glutathione peroxidase MGST2; GST2; leukotriene C4 synthase MGST2; MGC14097; MGST2; MGST-II; Microsomal glutathione S-transferase 2; microsomal glutathione S-transferase II; microsomal GST-2; Microsomal GST-II; Unknown (protein for MGC:127901)
Common Name MGST2
Gene Symbol MGST2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.