Invitrogen™ Human MGMT (aa 3-74) Control Fragment Recombinant Protein

Product Code. 30201497

Brand: Invitrogen™ RP104643

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

O6-Methylguanine-DNA Methyltransferase (MGMT) is an important DNA repair protein involved in tumor cell resistance to the cytostatic activity of chemotherapeutic alkylating agents. This protein is also effective in protecting normal cells against the genotoxic and carcinogenic effects of DNA alkylation. The alkylating drug resistance is caused by MGMT's ability to remove DNA alkyl groups introduced in the O6 position of guanine. MGMT is expressed in highly variable amounts, depending upon the cell and tissue type, species, and cellular growth characteristics. In addition, MGMT activity varies among groups of tumors and within a particular type of tumor.

Specifications

• Accession Number: P16455
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4255
• Name: Human MGMT (aa 3-74) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0-6-methylguanine-DNA methyltransferase; 6-O-methylguanine-DNA methyltransferase; Agat; AGT; AI267024; methylated DNA protein cysteine methyltransferase; methylated-DNA--protein-cysteine methyltransferase; methylguanine-DNA methyltransferase; MGMT; O(6)-alkylguanine-DNA alkyltransferase; O-6-alkylguanine-DNA alkyltransferase; O6-alkylguanine-DNA alkyltransferase; O-6-methylguan; O6-methylguanine-DNA methyltranferase; O-6-methylguanine-DNA methyltransferase; O6-methylguanine-DNA methyltransferase; O-6-methylguanine-DNA-alkyltransferase
• Common Name: MGMT
• Gene Symbol: MGMT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining